PDB entry 1oqu

View 1oqu on RCSB PDB site
Description: A protein coordinated tri-nuclear Fe complex formed during soaking of crystals of the ribonucleotide reductase R2F protein from Corynebacterium Ammoniagenes
Class: metal binding protein
Keywords: Mineralization, Ferritin, tri-iron, glutamate, METAL BINDING PROTEIN
Deposited on 2003-03-11, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqua_
  • Chain 'B':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqub_
  • Chain 'C':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oquc_
  • Chain 'D':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqud_
  • Heterogens: FE, OXY, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oquA (A:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oquA (A:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oquB (B:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oquB (B:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oquC (C:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oquC (C:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslsdddw
    df
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oquD (D:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oquD (D:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls