PDB entry 1oqm

View 1oqm on RCSB PDB site
Description: A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine
Class: transferase, biosynthetic protein
Keywords: alpha-lactalbumin, beta1,4-galactosyltransferase, UDP-GalNAc, TRANSFERASE, BIOSYNTHETIC PROTEIN
Deposited on 2003-03-10, released 2003-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oqma_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oqmb_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oqmc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oqmd_
  • Heterogens: CA, MN, UD2, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqmA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqmB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqmB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqmC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oqmD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqmD (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps