PDB entry 1opz

View 1opz on RCSB PDB site
Description: A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
Class: hydrolase
Keywords: mutation, folding, abbab fold, HYDROLASE
Deposited on 2003-03-06, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potential copper-transporting ATPase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yvgX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32220 (0-75)
      • engineered (45)
      • cloning artifact (72)
      • cloning artifact (74-75)
    Domains in SCOPe 2.07: d1opza1, d1opza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1opzA (A:)
    mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
    qekieklgyhvviegr