PDB entry 1opl

View 1opl on RCSB PDB site
Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
Class: transferase
Keywords: transferase
Deposited on 2003-03-06, released 2003-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.42 Å
R-factor: 0.306
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (Start-530)
      • engineered (381)
    Domains in SCOPe 2.03: d1opla1, d1opla2, d1opla3
  • Chain 'B':
    Compound: proto-oncogene tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519
      • engineered (381)
    Domains in SCOPe 2.03: d1oplb1, d1oplb2
  • Heterogens: MYR, P16

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oplA (A:)
    mgqqpgkvlgdqrrpslpalhfikgagkrdssrhggphcnvfvehealqrpvasdfepqg
    lseaarwnskenllagpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewce
    aqtkngqgwvpsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqr
    sislryegrvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrn
    kptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
    eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvll
    ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
    pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
    egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oplA (A:)
    dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
    lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
    gklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvspnydkwemertd
    itmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvql
    lgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfih
    rnlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksd
    vwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnps
    drpsfaeihqafetmfqessisdevekelgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oplB (B:)
    mgqqpgkvlgdqrrpslpalhfikgagkrdssrhggphcnvfvehealqrpvasdfepqg
    lseaarwnskenllagpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewce
    aqtkngqgwvpsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqr
    sislryegrvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrn
    kptvygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
    eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvll
    ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
    pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
    egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oplB (B:)
    slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
    dgklyvssesrfntlaelvhhhstvadglittlhypapdkwemertditmkhklgggqyg
    evyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvctreppfyii
    tefmtygnlldylrecnrqevnavvllymatqissameylekknfihrnlaarnclvgen
    hlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllweiat
    ygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafe
    tmfqe