PDB entry 1opk

View 1opk on RCSB PDB site
Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
Class: transferase
Keywords: transferase
Deposited on 2003-03-06, released 2003-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520
      • engineered (342)
    Domains in SCOPe 2.03: d1opka1, d1opka2, d1opka3
  • Heterogens: MYR, P16, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1opkA (A:)
    gamdpsealqrpvasdfepqglseaarwnskenllagpsendpnlfvalydfvasgdntl
    sitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvnslekhswyhgpvsrnaaeyl
    lssgingsflvresesspgqrsislryegrvyhyrintasdgklyvssesrfntlaelvh
    hhstvadglittlhypapkrnkptiygvspnydkwemertditmkhklgggqygevyegv
    wkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvctreppfyiitefmty
    gnlldylrecnrqevsavvllymatqissameylekknfihrnlaarnclvgenhlvkva
    dfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllweiatygmspy
    pgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    sisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opkA (A:)
    nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvnsle
    khswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasdgk
    lyvssesrfntlaelvhhhstvadglittlhypapkrnkptiygvspnydkwemertdit
    mkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllg
    vctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameylekknfihrn
    laarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvw
    afgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdr
    psfaeihqafetmfqessisdevekelgk