PDB entry 1opj

View 1opj on RCSB PDB site
Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
Class: transferase
Keywords: transferase
Deposited on 2003-03-06, released 2003-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (1-5)
    Domains in SCOPe 2.03: d1opja_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (2-5)
    Domains in SCOPe 2.03: d1opjb_
  • Heterogens: CL, MYR, STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1opjA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opjA (A:)
    amdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1opjB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opjB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk