PDB entry 1opj

View 1opj on RCSB PDB site
Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
Deposited on 2003-03-06, released 2003-04-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1opja_
  • Chain 'B':
    Domains in SCOP 1.65: d1opjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1opjA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opjA (A:)
    amdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1opjB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1opjB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk