PDB entry 1op9

View 1op9 on RCSB PDB site
Description:
Deposited on 2003-03-05, released 2003-10-14
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1op9a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1op9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1op9A (A:)
    qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads
    vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1op9B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv