PDB entry 1ooj

View 1ooj on RCSB PDB site
Description: Structural genomics of Caenorhabditis elegans : Calmodulin
Class: metal binding protein
Keywords: Structural genomics, Calmodulin, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, METAL BINDING PROTEIN
Deposited on 2003-03-03, released 2003-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin CMD-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ooja_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oojA (A:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oojA (A:)
    teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
    fpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdem
    ireadidgdgqvnyeefvtmm