PDB entry 1onv

View 1onv on RCSB PDB site
Description: NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNAP II CTD Phosphatase FCP1
Class: transcription
Keywords: Transcription Factor, Human General Transcription Factor TFIIF, RAP74, RNA Polymerase II CTD Phosphatase, TFIIF-associating CTD Phosphatase, FCP1
Deposited on 2003-03-02, released 2003-05-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor iif, alpha subunit
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1onva_
  • Chain 'B':
    Compound: serine phosphatase FCP1a
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onvA (A:)
    stpqppsgkttpnsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaq
    ilkrlnperkmindkmhfslke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onvA (A:)
    dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
    mhfslke
    

  • Chain 'B':
    No sequence available.