PDB entry 1onv

View 1onv on RCSB PDB site
Description: nmr structure of a complex containing the tfiif subunit rap74 and the rnap ii ctd phosphatase fcp1
Deposited on 2003-03-02, released 2003-05-20
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1onva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1onvA (A:)
stpqppsgkttpnsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaq
ilkrlnperkmindkmhfslke

    Sequence, based on observed residues (ATOM records): (download) 
    >1onvA (A:)
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke