PDB entry 1onh

View 1onh on RCSB PDB site
Description: GC1 beta-lactamase with a penem inhibitor
Class: hydrolase
Keywords: mixed alpha/beta, cephalosporinase, inhibition, class c beta-lactamase, hydrolase
Deposited on 2003-02-27, released 2003-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.138
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class C beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BLAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1onha_
  • Heterogens: WY4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onhA (A:)
    tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvman
    mapenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplp
    vaevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhil
    ealq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onhA (A:)
    pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
    apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
    aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
    alq