PDB entry 1onb

View 1onb on RCSB PDB site
Description: Solution structure of an engineered arginine-rich subdomain 2 of the hepatitis C virus NS3 RNA helicase
Class: hydrolase
Keywords: alpha-beta-alpha
Deposited on 2003-02-27, released 2003-03-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-11, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase NS3
    Species: Hepatitis C virus
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (4-141)
      • conflict (80)
      • conflict (95)
      • see remark 999 (108-111)
    Domains in SCOP 1.73: d1onba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1onbA (A:)
gshmgsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklv
alginavayyrgldvsviptngdvvvvatdalmtgftgdfdsvidcntsdgkpqdavsrt
qrrgrtgrgkpgiyrfvapger

    Sequence, based on observed residues (ATOM records): (download) 
    >1onbA (A:)
gsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalgi
navayyrgldvsviptngdvvvvatdalmtgftgdfdsvidcntsdgkpqdavsrtqrrg
rtgrgkpgiyrfvapger