PDB entry 1on7

View 1on7 on RCSB PDB site
Description: Unmethylated form of C-phycocyanin from Themosynechococcus vulcanus at 2.7A
Deposited on 2003-02-27, released 2003-07-29
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1on7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1on7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1on7A (A:)
    mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
    qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
    tfdlspswyiealkyikanhgltgqaaveanayidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1on7B (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava