PDB entry 1omd

View 1omd on RCSB PDB site
Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1990-04-19, released 1991-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oncomodulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1omda_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1omdA (A:)
    sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
    delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1omdA (A:)
    itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
    elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs