PDB entry 1omd

View 1omd on RCSB PDB site
Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1990-04-19, released 1991-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oncomodulin
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1omda_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1omdA (A:)
sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

    Sequence, based on observed residues (ATOM records): (download) 
    >1omdA (A:)
itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs