PDB entry 1omd

View 1omd on RCSB PDB site
Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Deposited on 1990-04-19, released 1991-07-15
The last revision prior to the SCOP 1.59 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1omd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1omd_ (-)
    itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
    elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs