PDB entry 1ol6

View 1ol6 on RCSB PDB site
Description: Structure of unphosphorylated D274N mutant of Aurora-A
Class: transferase
Keywords: transferase, cell cycle, serine/threonine-protein kinase, ATP-binding, phosphorylation
Deposited on 2003-08-06, released 2003-10-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.277
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (152)
    Domains in SCOPe 2.04: d1ol6a_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ol6A (A:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkianfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ol6A (A:)
    waledfeigrplgkkfgnvylarekqskfilalkvlfkaqlekaehqlrreveiqshlrh
    pnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychsk
    rvihrdikpenlllgsagelkianfgwsvhtldylppemiegmhdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss