PDB entry 1ol6

View 1ol6 on RCSB PDB site
Description: Structure of unphosphorylated D274N mutant of Aurora-A
Deposited on 2003-08-06, released 2003-10-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-30, with a file datestamp of 2003-10-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.277
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ol6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ol6A (A:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkianfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ol6A (A:)
    waledfeigrplgkkfgnvylarekqskfilalkvlfkaqlekaehqlrreveiqshlrh
    pnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychsk
    rvihrdikpenlllgsagelkianfgwsvhtldylppemiegmhdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss