PDB entry 1ojl

View 1ojl on RCSB PDB site
Description: crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding
Class: response regulator
Keywords: response regulator, two component system, aaa domain, ntrc family, DNA-binding, transcription regulation
Deposited on 2003-07-10, released 2005-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.25457
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-303)
  • Chain 'B':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-End)
    Domains in SCOPe 2.07: d1ojlb_
  • Chain 'C':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-End)
    Domains in SCOPe 2.07: d1ojlc_
  • Chain 'D':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-303)
  • Chain 'E':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-303)
  • Chain 'F':
    Compound: transcriptional regulatory protein zrar
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJL (Start-2)
    • Uniprot P25852 (3-End)
    Domains in SCOPe 2.07: d1ojlf_
  • Heterogens: PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ojlB (B:)
    gshmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtln
    caalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllrai
    qerevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrre
    diplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyi
    serelplaiaatpikteysgeiqplvdvekevilaalektggnkteaarqlgitrktlla
    klsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojlB (B:)
    shmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnc
    aalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllraiq
    erevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrred
    iplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyis
    erelplaiaat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ojlC (C:)
    gshmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtln
    caalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllrai
    qerevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrre
    diplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyi
    serelplaiaatpikteysgeiqplvdvekevilaalektggnkteaarqlgitrktlla
    klsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojlC (C:)
    shmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnc
    aalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllraiq
    erevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrred
    iplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyis
    erelplaiaatp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ojlF (F:)
    gshmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtln
    caalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllrai
    qerevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrre
    diplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyi
    serelplaiaatpikteysgeiqplvdvekevilaalektggnkteaarqlgitrktlla
    klsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojlF (F:)
    hmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnca
    alneslleselfghekgaftkrregrfveadggtlfldeigdisplmqvrllraiqerev
    qrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrredipll
    adhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyiserel
    plaiaat