PDB entry 1ojd

View 1ojd on RCSB PDB site
Description: human monoamine oxidase b in complex with lauryldimethylamine-n-oxide (ldao)
Class: oxidoreductase
Keywords: oxidoreductase, fad-containing amine oxidase, maob
Deposited on 2003-07-08, released 2003-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.25232
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojda1, d1ojda2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdb1, d1ojdb2
  • Chain 'C':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdc1, d1ojdc2
  • Chain 'D':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdd1, d1ojdd2
  • Chain 'E':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojde1, d1ojde2
  • Chain 'F':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdf1, d1ojdf2
  • Chain 'G':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdg1, d1ojdg2
  • Chain 'H':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdh1, d1ojdh2
  • Chain 'I':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdi1, d1ojdi2
  • Chain 'L':
    Compound: amine oxidase [flavin-containing] b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ojdl1, d1ojdl2
  • Heterogens: FAD, LDA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ojdA (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdA (A:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ojdB (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdB (B:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrlig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ojdC (C:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdC (C:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ojdD (D:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdD (D:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrlig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ojdE (E:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdE (E:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ojdF (F:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdF (F:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ojdG (G:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdG (G:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrlig
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ojdH (H:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdH (H:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltti
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ojdI (I:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdI (I:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ojdL (L:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojdL (L:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt