PDB entry 1oix

View 1oix on RCSB PDB site
Description: x-ray structure of the small g protein rab11a in complex with GDP and pi
Class: protein transport
Keywords: small g protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport
Deposited on 2003-06-26, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OIX
      • engineered mutation (87)
    • Uniprot P24410 (Start-190)
    Domains in SCOPe 2.07: d1oixa_
  • Heterogens: GDP, PO4, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oixA (A:)
    mrgshhhhhhgiplpgramgtrddeydylfkvvligdsgvgksnllsrftrnefnlesks
    tigvefatrsiqvdgktikaqiwdtagleryraitsayyrgavgallvydiakhltyenv
    erwlkelrdhadsnivimlvgnksdlrhlravptdearafaeknglsfietsaldstnve
    aafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oixA (A:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy