PDB entry 1oiv

View 1oiv on RCSB PDB site
Description: x-ray structure of the small g protein rab11a in complex with GDP
Class: protein transport
Keywords: protein transport, small g protein, intracellular trafficking, GTP-binding, lipoprotein
Deposited on 2003-06-26, released 2004-01-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OIV
    • Uniprot P24410 (Start-190)
    Domains in SCOPe 2.03: d1oiva_
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OIV
    • Uniprot P24410 (Start-190)
    Domains in SCOPe 2.03: d1oivb_
  • Heterogens: GDP, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oivA (A:)
    mrgshhhhhhgiplpgramgtrddeydylfkvvligdsgvgksnllsrftrnefnlesks
    tigvefatrsiqvdgktikaqiwdtagqeryraitsayyrgavgallvydiakhltyenv
    erwlkelrdhadsnivimlvgnksdlrhlravptdearafaeknglsfietsaldstnve
    aafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oivA (A:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oivB (B:)
    mrgshhhhhhgiplpgramgtrddeydylfkvvligdsgvgksnllsrftrnefnlesks
    tigvefatrsiqvdgktikaqiwdtagqeryraitsayyrgavgallvydiakhltyenv
    erwlkelrdhadsnivimlvgnksdlrhlravptdearafaeknglsfietsaldstnve
    aafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oivB (B:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy