PDB entry 1oia

View 1oia on RCSB PDB site
Description: u1a rnp domain 1-95
Class: ribonucleoprotein
Keywords: ribonucleoprotein, nuclear protein, RNA-binding
Deposited on 2003-06-12, released 2003-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1oiaa_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1oiab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oiaA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiaA (A:)
    vpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkev
    ssatnalrsmqgfpfydkpmriqyaktdsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oiaB (B:)
    mavpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiaB (B:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktds