PDB entry 1oi9

View 1oi9 on RCSB PDB site
Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Class: kinase
Keywords: kinase, transferase, serine/threonine-protein kinase, ATP-binding, cell cycle, cell division, mitosis, phosphorylation
Deposited on 2003-06-10, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.233
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI9 (176-176)
    • Uniprot P24941 (4-End)
    Domains in SCOPe 2.07: d1oi9a1, d1oi9a2
  • Chain 'B':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oi9b1, d1oi9b2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI9 (176-176)
    • Uniprot P24941 (4-End)
    Domains in SCOPe 2.07: d1oi9c1, d1oi9c2
  • Chain 'D':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oi9d1, d1oi9d2
  • Heterogens: N20, SGM, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi9A (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi9A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirltetegvpstaireisllkelnh
    pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
    hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
    stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
    pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi9B (B:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi9B (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oi9C (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi9C (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oi9D (D:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi9D (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetl