PDB entry 1oi7

View 1oi7 on RCSB PDB site
Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus
Class: synthetase
Keywords: synthetase, succinyl-coa synthetase, scs, ligase, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2003-06-10, released 2003-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.178
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-coa synthetase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09143 (0-287)
      • engineered mutation (28)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d1oi7a1, d1oi7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi7A (A:)
    milvnretrvlvqgitgregqfhtkqmltygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapk
    gkrmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi7A (A:)
    milvnretrvlvqgitgregqfhtkqmltygtkivagvtpgkggmevlgvpvydtvkeav
    ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
    gncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggd
    pvigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrvgtp
    esklrafaeagipvadtideivelvkkalg