PDB entry 1oi2

View 1oi2 on RCSB PDB site
Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli
Deposited on 2003-06-04, released 2003-06-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-10, with a file datestamp of 2003-07-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17231
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi2A (A:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi2A (A:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi2B (B:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi2B (B:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk