PDB entry 1oi0

View 1oi0 on RCSB PDB site
Description: crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus
Class: hydrolase
Keywords: proteasome, deubiquitination, archaea, hydrolase
Deposited on 2003-06-04, released 2003-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein af2198
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI0 (0-2)
    • Uniprot O28085 (3-End)
    Domains in SCOPe 2.07: d1oi0a_
  • Chain 'B':
    Compound: hypothetical protein af2198
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI0
    • Uniprot O28085 (3-End)
    Domains in SCOPe 2.07: d1oi0b_
  • Chain 'C':
    Compound: hypothetical protein af2198
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI0 (0-2)
    • Uniprot O28085 (3-End)
    Domains in SCOPe 2.07: d1oi0c_
  • Chain 'D':
    Compound: hypothetical protein af2198
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI0
    • Uniprot O28085 (3-End)
    Domains in SCOPe 2.07: d1oi0d_
  • Heterogens: ZN, 144, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi0A (A:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
    igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
    vekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi0A (A:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsigmkvfgtvhshp
    spscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi0B (B:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
    igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
    vekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi0B (B:)
    mkisrgllktileaaksahpdefiallsgskdvmdeliflpflpigmkvfgtvhshpsps
    crpseedlslftrfgkyhiivcypydenswkcynrkgeevelevve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oi0C (C:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
    igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
    vekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi0C (C:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflgmkvfgtvhshpspscr
    pseedlslftrfgkyhiivcypydenswkcynrkgeevelevve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oi0D (D:)
    gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
    igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
    vekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi0D (D:)
    mkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgpigmkvfgtvhshps
    pscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevve