PDB entry 1og0

View 1og0 on RCSB PDB site
Description: crystal structure of the mutant g226s of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phenylalanine and manganese
Class: lyase
Keywords: beta-alpha-barrel, lyase
Deposited on 2003-04-22, released 2004-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0a_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0b_
  • Chain 'C':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0c_
  • Chain 'D':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0d_
  • Chain 'E':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0e_
  • Chain 'F':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449 (Start-369)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0f_
  • Chain 'G':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0g_
  • Chain 'H':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32449
      • engineered mutation (225)
    Domains in SCOPe 2.07: d1og0h_
  • Heterogens: PHE, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1og0A (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0A (A:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylwkglindpdvnntfninkglqsarqlf
    vnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkngtd
    gtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksvaea
    kaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegnqg
    ipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1og0B (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0B (B:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekpvgwkglindpdvnntfninkglqsa
    rqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfk
    ngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaegkalkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1og0C (C:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0C (C:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekwkglindpdvnntfninkglqsarq
    lfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkng
    tdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksva
    eakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegn
    qgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1og0D (D:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0D (D:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprgwkglindpdvnntfninkglqs
    arqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgf
    kngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydak
    svaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnin
    egnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1og0E (E:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0E (E:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylglindpdvnntfninkglqsarqlfvn
    ltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkngtdgt
    lnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksvaeaka
    qlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegnqgip
    kygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1og0F (F:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0F (F:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipgkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1og0G (G:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0G (G:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsarq
    lfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkng
    tdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksva
    eakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegn
    qipaeaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1og0H (H:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1og0H (H:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmsvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaaglkygvsitdacigwettedvlrklaaavrqrrevnk