PDB entry 1ofr

View 1ofr on RCSB PDB site
Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phenylalanine and manganese
Deposited on 2003-04-18, released 2004-04-15
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-15, with a file datestamp of 2004-04-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ofra_
  • Chain 'B':
    Domains in SCOP 1.67: d1ofrb_
  • Chain 'C':
    Domains in SCOP 1.67: d1ofrc_
  • Chain 'D':
    Domains in SCOP 1.67: d1ofrd_
  • Chain 'E':
    Domains in SCOP 1.67: d1ofre_
  • Chain 'F':
    Domains in SCOP 1.67: d1ofrf_
  • Chain 'G':
    Domains in SCOP 1.67: d1ofrg_
  • Chain 'H':
    Domains in SCOP 1.67: d1ofrh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofrA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrA (A:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylekprtvgwkglindpdvnntfninkglqs
    arqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgf
    kngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydak
    svaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnin
    egnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofrB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrB (B:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglqs
    arqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgf
    kngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkgtnydaks
    vaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnine
    gnqgipaegkalkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ofrC (C:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrC (C:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglqsa
    rqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfk
    ngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaks
    vaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnine
    gnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ofrD (D:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrD (D:)
    gaeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcs
    ihdleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglq
    sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
    fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
    ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
    negnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ofrE (E:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrE (E:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsarql
    fvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkngt
    dgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksvae
    akaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegnq
    gipkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ofrF (F:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrF (F:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylekprvgwkglindpdvnntfninkglqsa
    rqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfk
    ngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaks
    vaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnine
    gnqgipgkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ofrG (G:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrG (G:)
    aeedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsi
    hdleaaqeyalrlkklsdelkgdlsiimraylekpgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqipaeaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ofrH (H:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofrH (H:)
    eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
    dleaaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglq
    sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
    fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
    ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
    negnqgipaaglkygvsitdacigwettedvlrklaaavrqrrevnk