PDB entry 1ofb

View 1ofb on RCSB PDB site
Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with manganese(II)
Class: lyase
Keywords: beta-alpha-barrel, lyase, aromatic amino-acid biosynthesis synthase, aldolase, synthetase, manganese
Deposited on 2003-04-09, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofba_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofbb_
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofbA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofbA (A:)
    edvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihd
    leaaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqs
    arqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgf
    kngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydak
    svaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnin
    egnqgipaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofbB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofbB (B:)
    dvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdl
    eaaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsa
    rqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfk
    ngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaks
    vaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnine
    gnqgikygvsitdacigwettedvlrklaaavrqrrevnk