PDB entry 1ofa

View 1ofa on RCSB PDB site
Description: Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with phosphoenolpyruvate and cobalt(ii)
Class: lyase
Keywords: beta-alpha-barrel, lyase, aromatic amino-acid biosynthesis synthase, aldolase, synthetase, manganese
Deposited on 2003-04-09, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.155
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofaa_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ofab_
  • Heterogens: CO, PEP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ofaA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofaA (A:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ofaB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ofaB (B:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgkygvsitdacigwettedvlrklaaavrqrrevnk