PDB entry 1of8

View 1of8 on RCSB PDB site
Description: double complex of the tyrosine sensitive DAHP Synthase from S. cerevisiae with Co2+, PEP and the E4P analogoue G3P
Class: lyase
Keywords: beta-alpha-barrel, lyase, synthase, aldolase, synthetase
Deposited on 2003-04-08, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1266
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1of8a_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1of8b_
  • Heterogens: CO, PEP, G3P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1of8A (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of8A (A:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgilkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1of8B (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1of8B (B:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipkaglkygvsitdacigwettedvlrklaaavrqrrevnk