PDB entry 1oez

View 1oez on RCSB PDB site
Description: zn his46arg mutant of human cu, zn superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, human cu, zn superoxide dismutase
Deposited on 2003-04-02, released 2003-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'W':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d1oezw_
  • Chain 'X':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d1oezx_
  • Chain 'Y':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d1oezy_
  • Chain 'Z':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d1oezz_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1oezW (W:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oezW (W:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddsrlacgv
    igiaq
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1oezX (X:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oezX (X:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddsrlacgv
    igiaq
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1oezY (Y:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oezY (Y:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddsrlacgv
    igiaq
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1oezZ (Z:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oezZ (Z:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddsrlacgv
    igiaq