PDB entry 1oet

View 1oet on RCSB PDB site
Description: oxidation state of protein tyrosine phosphatase 1b
Class: hydrolase
Keywords: hydrolase, protein tyrosine phosphatase, oxidative regulation, phosphorylation
Deposited on 2003-03-31, released 2003-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: -tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oeta_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oetA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oetA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim