PDB entry 1oep

View 1oep on RCSB PDB site
Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site
Class: lyase
Keywords: lyase, glycolysis, his-tag
Deposited on 2003-03-28, released 2003-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OEP (Start-2)
      • conflict see remark 9 (30)
      • conflict see remark 9 (193)
    • Uniprot Q9NDH8 (3-431)
    Domains in SCOPe 2.06: d1oepa1, d1oepa2
  • Heterogens: ZN, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oepA (A:)
    gshmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkry
    vgkgclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmais
    kaaaaakgvplyrylaslagtkelrlpvpcfnvinggkhagnalpfqefmiapvkatsfs
    ealrmgsevyhslkgiikkkygqdavnvgdeggfappikdineplpilmeaieeaghrgk
    faicmdcaasetydekkqqynltfkspeptwvtaeqlretyckwahdypivsiedpydqd
    dfagfagitealkgktqivgddltvtnterikmaiekkacnslllkinqigtiseaiass
    klcmengwsvmvshrsgetedtyiadlvvalgsgqiktgapcrgertaklnqllrieeel
    gahakfgfpgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oepA (A:)
    shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgasvyeacelrdgdkkryvgk
    gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
    aaakgvplyrylaslagtkelrlpvpcfnvinggkhagnalpfqefmiapvkatsfseal
    rmgsevyhslkgiikkkygqdavnvgdeggfappikdineplpilmeaieeaghrgkfai
    cmdcaasetydekkqqynltwvtaeqlretyckwahdypivsiedpydqddfagfagite
    alkgktqivgddltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsv
    mvshrsgetedtyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpg
    ws