PDB entry 1oen

View 1oen on RCSB PDB site
Description: phosphoenolpyruvate carboxykinase
Class: kinase
Keywords: p-loop, nucleotide-triphosphate hydrolase, kinase
Deposited on 1995-09-08, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22259 (Start-539)
      • conflict (239)
      • conflict (251)
      • frameshift error (261)
      • frameshift error (284)
      • frameshift error (301)
      • conflict (316-317)
      • conflict (389-390)
      • conflict (451-452)
      • frameshift error (491)
      • frameshift error (503-504)
      • frameshift error (538)
    Domains in SCOPe 2.06: d1oena1, d1oena2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oenA (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgea
    gdvavffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepei
    yaairrdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaaaagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnl
    aiptelpgvdtgildprntyaspagwqekaetlaklfidnfdkytdtpagaalvaagpal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oenA (A:)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgeagdvav
    ffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepeiyaair
    rdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaaaaptptfsacfgaaflslhptqyaevlvkrmqaag
    aqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnlaiptelpgvdtgi
    ldprntyagwqekaetlaklfidnfdkytdtpagaalvaagpal