PDB entry 1oen

View 1oen on RCSB PDB site
Description: phosphoenolpyruvate carboxykinase
Deposited on 1995-09-08, released 1996-11-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1oen__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1oen_ (-)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgeagdvav
    ffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepeiyaair
    rdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaaaagtergiteptptfsacfgaaflslhptqyaevl
    vkrmqaagaqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnlaipte
    lpgvdtgildprntyaspagwqekaetlaklfidnfdkytdtpagaalvaagpal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oen_ (-)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgeagdvav
    ffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepeiyaair
    rdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaaaaptptfsacfgaaflslhptqyaevlvkrmqaag
    aqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnlaiptelpgvdtgi
    ldprntyagwqekaetlaklfidnfdkytdtpagaalvaagpal