PDB entry 1oe1

View 1oe1 on RCSB PDB site
Description: atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Class: reductase
Keywords: reductase, denitrification, nitrite reductase
Deposited on 2003-03-18, released 2003-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.1175
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oe1a1, d1oe1a2
  • Heterogens: CU, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oe1A (A:)
    edadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr