PDB entry 1ody

View 1ody on RCSB PDB site
Description: hiv-1 protease complexed with an inhibitor lp-130
Class: aspartic protease
Keywords: aspartic protease, retropepsin, retrovirus, hiv, aids
Deposited on 1998-07-13, released 1999-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Database cross-references and differences (RAF-indexed):
    • PIR S63716 (0-98)
      • conflict (40)
      • conflict (45)
    Domains in SCOPe 2.06: d1odya_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Database cross-references and differences (RAF-indexed):
    • PIR S63716 (0-98)
      • conflict (40)
      • conflict (45)
    Domains in SCOPe 2.06: d1odyb_
  • Heterogens: LP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1odyA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1odyB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf