PDB entry 1oda

View 1oda on RCSB PDB site
Description: n-terminal of sialoadhesin in complex with me-a-9-n-(biphenyl-4-carbonyl)-amino-9-deoxy-neu5ac (bip compound)
Class: lectin/immune system
Keywords: lectin/immune system, immune system, immunoglobulin superfamily, carbohydrate binding, siglec, inhibitor design, cell adhesion
Deposited on 2003-02-14, released 2003-08-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1odaa_
  • Heterogens: BDU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1odaA (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1odaA (A:)
    twgvsspknvqglsgscllipcifsypadvpvgitaiwyydysgkrqvvihsgdpklvdk
    rfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd