PDB entry 1od9

View 1od9 on RCSB PDB site
Description: n-terminal of sialoadhesin in complex with me-a-9-n-benzoyl-amino-9-deoxy-neu5ac (benz compound)
Class: lectin/immune system
Keywords: lectin/immune system, immune system, immunoglobulin superfamily, carbohydrate binding, siglec, inhibitor design
Deposited on 2003-02-14, released 2003-05-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1od9a_
  • Heterogens: BND, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1od9A (A:)
    twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
    dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd