PDB entry 1od7

View 1od7 on RCSB PDB site
Description: n-terminal of sialoadhesin in complex with me-a-9-n-(naphthyl-2-carbonyl)-amino-9-deoxy-neu5ac (nap compound)
Class: lectin/immnue system
Keywords: lectin/immnue system, immune system, immunoglobulin superfamily, carbohydrate binding, siglec, inhibitor design, cell adhesion
Deposited on 2003-02-14, released 2003-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.192
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sialoadhesin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62230 (0-118)
  Domains in SCOPe 2.03: d1od7a_
• Heterogens: SUW

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1od7A (A:)
  twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
  dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd