PDB entry 1od5

View 1od5 on RCSB PDB site
Description: crystal structure of glycinin a3b4 subunit homohexamer
Class: globulin
Keywords: glycinin, soybean, globulin, 11s, seed storage protein
Deposited on 2003-02-13, released 2003-06-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1od5a1, d1od5a2
  • Chain 'B':
    Compound: glycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1od5b1, d1od5b2
  • Heterogens: CO3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1od5A (A:)
    tsskfnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlps
    yspypqmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegd
    vlvippgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqq
    qqkshggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtve
    gglsvispkwqeqededededeeyeqtpsypprrpshgkheddededeeedqprpdhppq
    rpsrpeqqeprgrgcqtrngveenictmklheniarpsradfynpkagristlnsltlpa
    lrqfglsaqyvvlyrngiysphwnlnansviyvtrgkgrvrvvncqgnavfdgelrrgql
    lvvpqnfvvaeqggeqgleyvvfkthhnavssyikdvfraipsevlsnsynlgqsqvrql
    kyqgnsgplvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od5A (A:)
    necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
    qmiivvqgkgaigfafpgcpetfekpqdshqkirhfnegdvlvippgvpywtyntgdepv
    vaislldtsnfnnqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaqsfntned
    taeklrspdderkqivtvegglsvispkwgveenictmklheniarpsradfynpkagri
    stlnsltlpalrqfglsaqyvvlyrngiysphwnlnansviyvtrgkgrvrvvncqgnav
    fdgelrrgqllvvpqnfvvaeqggeqgleyvvfkthhnavssyikdvfraipsevlsnsy
    nlgqsqvrqlkyqgnsgplvnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1od5B (B:)
    tsskfnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlps
    yspypqmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegd
    vlvippgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqq
    qqkshggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtve
    gglsvispkwqeqededededeeyeqtpsypprrpshgkheddededeeedqprpdhppq
    rpsrpeqqeprgrgcqtrngveenictmklheniarpsradfynpkagristlnsltlpa
    lrqfglsaqyvvlyrngiysphwnlnansviyvtrgkgrvrvvncqgnavfdgelrrgql
    lvvpqnfvvaeqggeqgleyvvfkthhnavssyikdvfraipsevlsnsynlgqsqvrql
    kyqgnsgplvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1od5B (B:)
    necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
    qmiivvqgkgaigfafpgcpetfekpqdshqkirhfnegdvlvippgvpywtyntgdepv
    vaislldtsnfnnqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaqsfntned
    taeklrspdderkqivtvegglsvispkwgveenictmklheniarpsradfynpkagri
    stlnsltlpalrqfglsaqyvvlyrngiysphwnlnansviyvtrgkgrvrvvncqgnav
    fdgelrrgqllvvpqnfvvaeqggeqgleyvvfkthhnavssyikdvfraipsevlsnsy
    nlgqsqvrqlkyqgnsgplvnp