PDB entry 1ocy

View 1ocy on RCSB PDB site
Description: structure of the receptor-binding domain of the bacteriophage t4 short tail fibre
Deposited on 2003-02-11, released 2003-07-24
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-24, with a file datestamp of 2003-07-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1434
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ocya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ocyA (A:)
rvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggsssn
pglpdmrglfvrgsgrgshltnpnvngndqfgkprlgvgctggyvgevqkqqmsyhkhag
gfgeyddsgafgntrrsnfvgtrkgldwdnrsyftndgyeidpasqrnsrytlnrpelig
netrpwnislnyiikvke