PDB entry 1ocw

View 1ocw on RCSB PDB site
Description: Free conformation Ab2 of the IgE SPE-7
Class: immune system
Keywords: antibody, allergy, conformational diversity, immune system, multispecificity
Deposited on 2003-02-11, released 2004-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2671
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OCW (0-End)
    Domains in SCOPe 2.05: d1ocwh_
  • Chain 'L':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OCW (0-End)
    Domains in SCOPe 2.05: d1ocwl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ocwH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ocwH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ocwL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvleqpksspsvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ocwL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle