PDB entry 1oco

View 1oco on RCSB PDB site
Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
Deposited on 1998-07-09, released 1999-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-22, with a file datestamp of 1999-07-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ocoa1
  • Chain 'B':
    Domains in SCOP 1.55: d1ocob1, d1ocob2
  • Chain 'C':
    Domains in SCOP 1.55: d1ococ1
  • Chain 'D':
    Domains in SCOP 1.55: d1ocod1
  • Chain 'E':
    Domains in SCOP 1.55: d1ocoe_
  • Chain 'F':
    Domains in SCOP 1.55: d1ocof_
  • Chain 'G':
    Domains in SCOP 1.55: d1ocog1
  • Chain 'H':
    Domains in SCOP 1.55: d1ocoh_
  • Chain 'I':
    Domains in SCOP 1.55: d1ocoi1
  • Chain 'J':
    Domains in SCOP 1.55: d1ocoj1
  • Chain 'K':
    Domains in SCOP 1.55: d1ocok1
  • Chain 'L':
    Domains in SCOP 1.55: d1ocol1
  • Chain 'M':
    Domains in SCOP 1.55: d1ocom1
  • Chain 'N':
    Domains in SCOP 1.55: d1ocon1
  • Chain 'O':
    Domains in SCOP 1.55: d1ocoo1, d1ocoo2
  • Chain 'P':
    Domains in SCOP 1.55: d1ocop1
  • Chain 'Q':
    Domains in SCOP 1.55: d1ocoq1
  • Chain 'R':
    Domains in SCOP 1.55: d1ocor_
  • Chain 'S':
    Domains in SCOP 1.55: d1ocos_
  • Chain 'T':
    Domains in SCOP 1.55: d1ocot1
  • Chain 'U':
    Domains in SCOP 1.55: d1ocou_
  • Chain 'V':
    Domains in SCOP 1.55: d1ocov1
  • Chain 'W':
    Domains in SCOP 1.55: d1ocow1
  • Chain 'X':
    Domains in SCOP 1.55: d1ocox1
  • Chain 'Y':
    Domains in SCOP 1.55: d1ocoy1
  • Chain 'Z':
    Domains in SCOP 1.55: d1ocoz1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
    ywhfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoH (H:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
    ywhfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoU (U:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfp
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ocoZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks