PDB entry 1oce

View 1oce on RCSB PDB site
Description: acetylcholinesterase (e.c. 3.1.1.7) complexed with mf268
Class: hydrolase
Keywords: hydrolase, carboxylic esterase, neurotransmitter cleavage, serine esterase
Deposited on 1998-06-12, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ocea_
  • Heterogens: MF2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oceA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oceA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    eskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat