PDB entry 1ob2

View 1ob2 on RCSB PDB site
Description: E. coli elongation factor EF-Tu complexed with the antibiotic kirromycin, a GTP analog, and Phe-tRNA
Class: hydrolase/nuclear protein
Keywords: HYDROLASE/NUCLEAR PROTEIN, HYDROLASE, GTPASE, TRANSLATION ELONGATION FACTOR, TRANSFER RNA, HYDROLASE-NUCLEAR PROTEIN complex
Deposited on 2003-01-24, released 2004-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.22
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CE48 (0-392)
      • conflict (0)
    Domains in SCOPe 2.05: d1ob2a1, d1ob2a2, d1ob2a3
  • Chain 'B':
    Compound: transfer-RNA, phe
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Heterogens: KIR, SUC, GNP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ob2A (A:)
    akekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    No sequence available.