PDB entry 1oaz

View 1oaz on RCSB PDB site
Description: IgE Fv SPE7 complexed with a recombinant thioredoxin
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-15, with a file datestamp of 2004-01-15.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.2078
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oaza_
  • Chain 'B':
    Domains in SCOP 1.67: d1oazb_
  • Chain 'H':
    Domains in SCOP 1.67: d1oazh_
  • Chain 'J':
    Domains in SCOP 1.67: d1oazj_
  • Chain 'L':
    Domains in SCOP 1.67: d1oazl_
  • Chain 'N':
    Domains in SCOP 1.67: d1oazn_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oazA (A:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildei
    adeyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkeflda
    nla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oazA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeil
    tvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oazB (B:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildei
    adeyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkeflda
    nla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oazB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpieesddrrydlvgpckmiapildeil
    tvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oazH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oazJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oazL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oazL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oazN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oazN (N:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl